applying a function to multiple lists (R) - r

I have two lists:
source <- list(c(5,10,20,30))
source.val <- list(c('A', 'B', 'C', 'D'))
Each corresponding element in source has a corresponding value in source.val. I want to create dataframe from the above two files that look like below
source.val_5 source.val_10 source.val_20 source.val_30
A B C D
I did this
tempList <- list()
for(i in 1:lengths(source)){
tempList[[i]] <- data.frame(variable = paste0('source.val_',source[[1]][[i]]),
value = source.val[[1]][[i]])
}
temp.dat <- do.call('rbind', tempList)
temp.dat_wider <- tidyr::pivot_wider(finalList, id_cols = value, names_from = variable)
Now I want to do this across a bigger list
source <- list(c(5,10,20,30),
c(5,10,20,30),
c(5,10,20,30),
c(5,10,20,30))
source.val <- list(c('A', 'B', 'C', 'D'),
c('B', 'B', 'D', 'D'),
c('C', 'B', 'A', 'D'),
c('D', 'B', 'B', 'D'))
The resulting table will have 4 rows looking like this:
A tibble: 1 x 4
source.val_5 source.val_10 source.val_20 source.val_30
A B C D
B B D D
C B A D
D B B D
What is the best way to use function like mapply to achieve my desired result?

For the example shared, where all the elements of source have the same order you can do :
cols <- paste0('source.val_', sort(unique(unlist(source))))
setNames(do.call(rbind.data.frame, source.val), cols)
# source.val_5 source.val_10 source.val_20 source.val_30
#1 A B C D
#2 B B D D
#3 C B A D
#4 D B B D
However, for a general case where every value in source do not follow the same order you can reorder source.val based on source :
source.val <- Map(function(x, y) y[order(x)], source, source.val)
and then use the above code.

Related

Extracting a single unique character from a pattern in R

I have a data frame of unique character vectors that are all very similar to a distinct pattern, but with small deviations in each. I'm hoping to find a way to identify what the deviation is in each string. Here is what I have tried:
library(stringr)
#The strings are concatenated in my code, I separated them for easier use
KeyPattern <- c('abcd'
uniqchars <- function(x) unique(strsplit(x, "")[[1]])
KayPattern <- uniqchars(KeyPattern)
> KeyPattern
[1] "a" "b" "c" "d"
SampleString <- c('a', 'b', 'z', 'c', 'd')
str_detect(SampleString, KeyPattern)
[1] TRUE TRUE FALSE FALSE FALSE
As you can see, it recognizes the 'z' character, and correctly returns FALSE, and from there the pattern is completely off. I also considered trying:
word(string, start = 1L, end = start, sep = fixed(" "))
but this requires a pre-existing knowledge of where the deviations are (start = ..., end = ...) and it will be different in every row of the data frame.
Ultimately I want to have a data frame with one column of unique string, a column of distinct deviations (mismatches in the pattern), and it's location in the string.
Goal Sample Table:
String
Deviation from Key
Deviation start location
'a' 'b' 'c' 'z' 'd'
z
4
'a' 'b' 'a' 'c' 'd'
a
3
Current concatenated data frame:
1 ASGGGGSAASHLIALQLRLIGDAFDGGGGSGGGGSG
2 ASLTVDVGNVTYHFNNPITVLVFAILVALELGGTVHVHGNRIHVEG
3 ASLTVHVGDLTYHFENPQLVKLVAEIWARALNLTIEIRGNEIHVEG
4 ASNELVELVVEILYRMCVDPDQIKKILKRRGVSDEEVKRAIDKAIG
5 ASNMNMLEALQQRLQFYFGVVSRAALENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPVPPGFGG
6 ASNTIMLEALQQRLQFYFGVVSRAALENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPVPPGFGG
#CurrentKey
[1] "ASSTNMLEALQQRLQFYFGVVSRALENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPVPPGFGG"
Any suggestions?
see if this what you want?
df <- structure(list(STRINGS = list(c("a", "b", "c", "z", "d"), c("a",
"b", "a", "c", "d"))), class = "data.frame", row.names = c(NA,
-2L))
df
#> STRINGS
#> 1 a, b, c, z, d
#> 2 a, b, a, c, d
pattern <- c('a', 'b', 'c', 'd')
library(tidyverse)
df %>%
mutate(deviation = map_chr(STRINGS, ~ {x <- cumsum(.x[seq_along(pattern)] != pattern); .x[which(x >0)[1]]}),
deviation_start_loc = map_int(STRINGS, ~ {x <- cumsum(.x[seq_along(pattern)] != pattern); which(x > 0)[1]}))
#> STRINGS deviation deviation_start_loc
#> 1 a, b, c, z, d z 4
#> 2 a, b, a, c, d a 3
Created on 2021-06-21 by the reprex package (v2.0.0)
Here is my approach:
First, define a recursive function:
find_deviation <- function(string, key, position = 1) {
stopifnot(is.character(string), is.character(key))
if (min(length(key), length(string)) == 0)
return(c(deviation = NA, position = NA))
if (string[1] != key[1])
return(c(deviation = string[1], position = position))
find_deviation(string[-1], key[-1], position + 1)
}
Then, use it to generate the desired result:
dplyr::bind_cols(
purrr::map_dfr(SampleString, ~ c(String = paste(.x, collapse = ","))),
purrr::map_dfr(SampleString, ~ find_deviation(.x, KeyPattern))
)
Result:
# A tibble: 2 x 3
String deviation position
<chr> <chr> <chr>
1 a,b,z,c,d z 3
2 a,b,a,c,d a 3
Data used:
KeyPattern <- c('a', 'b', 'c', 'd')
SampleString <- list(c('a', 'b', 'z', 'c', 'd'), c('a', 'b', 'a', 'c', 'd'))
Using aphid library and sequence alignment, the character vectors are combined into a list, the first element being the key pattern vector.
library(aphid)
KeyPattern <- c('a', 'b', 'c', 'd')
SampleString1 <- c('a', 'b', 'z', 'c', 'd')
SampleString2 <- c('a', 'b', 'c', 'z', 'd')
SampleString3 <- c('a', 'b', 'a', 'c', 'd')
sequences=list(KeyPattern,SampleString1,SampleString2,SampleString3)
do.call(rbind,
sapply(2:length(sequences),function(x){
glo=align(sequences[c(1,x)],type="global",k=1)
tmp=glo[1,]!=glo[2,]
data.frame(
"String"=paste0(sequences[[x]],collapse=" "),
"Deviation from Key"=glo[2,tmp],
"Deviation start location"=which(tmp)
)
},simplify=F)
)
String Deviation.from.Key Deviation.start.location
1 a b z c d z 3
2 a b c z d z 4
3 a b a c d a 3

Count number of time combination of events appear in dataframe columns ext

This is an extension of the question asked in Count number of times combination of events occurs in dataframe columns, I will reword the question again so it is all here:
I have a data frame and I want to calculate the number of times each combination of events in two columns occur (in any order), with a zero if a combination doesn't appear.
For example say I have
df <- data.frame('x' = c('a', 'b', 'c', 'c', 'c'),
'y' = c('c', 'c', 'a', 'a', 'b'))
So
x y
a c
b c
c a
c a
c a
c b
a and b do not occur together, a and c 4 times (rows 2, 4, 5, 6) and b and c twice (3rd and 7th rows) so I would want to return
x-y num
a-b 0
a-c 4
b-c 2
I hope this makes sense? Thanks in advance
This should do it:
res = table(df)
To convert to data frame:
resdf = as.data.frame(res)
The resdf data.frame looks like:
x y Freq
1 a a 0
2 b a 0
3 c a 2
4 a b 0
5 b b 0
6 c b 1
7 a c 1
8 b c 1
9 c c 0
Note that this answer takes order into account. If ordering of the columns is unimportant, then modifying the original data.frame prior to the process will remove the effect of ordering (a-c treated the same as c-a).
df1 = as.data.frame(t(apply(df,1,sort)))
As said, you can do this with factor() and expand.grid() (or another way to get all possible combinations)
all.possible <- expand.grid(c('a','b','c'), c('a','b','c'))
all.possible <- all.possible[all.possible[, 1] != all.possible[, 2], ]
all.possible <- unique(apply(all.possible, 1, function(x) paste(sort(x), collapse='-')))
df <- data.frame('x' = c('a', 'b', 'c', 'c', 'c'),
'y' = c('c', 'c', 'a', 'a', 'b'))
table(factor(apply(df , 1, function(x) paste(sort(x), collapse='-')), levels=all.possible))
An alternative, because I was a bit bored. Perhaps a bit more generalised? But probably still uglier than it could be...
df2 <- as.data.frame(table(df))
df2$com <- apply(df2[,1:2],1,function(x) if(x[1] != x[2]) paste(sort(x),collapse='-'))
df2 <- df2[df2$com != "NULL",]
ddply(df2, .(unlist(com)), summarise,
num = sum(Freq))

Creating a co-authoriship network in r

I would like to create a co-authorship network using igraph .
My data are organized in a data.frame which looks like that:
DF1 <- cbind(Papers = paste('Paper', 1:5, sep = ''),
Author1 = c('A', 'D', 'C', 'C', 'C'),
Author2 = c('B', 'C', 'F', NA, 'F'),
Author3 = c('C', 'E', NA, NA, 'D'))
I would like to create an Edge list which looks like this:
Vertex1 Vertex2
A B
D C
C F
C F
A C
D E
C D
B C
C E
F D
Is there anyway to do this in R (igraph for example)
The following function does the trick but for large dataset (over 5,000 papers) it takes too long to run
Fun_DFtoEdgeList <- function (Inputdataframe)
{
## This function create an edge list to create a network
## Input : Dataframe with UNIQUE VALUES !!!!
ResEdgeList <- data.frame(Vertex1 = c('--'), Vertex2 = c('--'))
for (i in 1 : (ncol(Inputdataframe)-1))
{
for (j in 2: (ncol(Inputdataframe)))
{
if (i !=j)
{
#print(paste(i, j, sep ='--'))
ToAppend <- data.frame(cbind(Inputdataframe[,i], Inputdataframe[,j]))
names(ToAppend) <- names(ResEdgeList)
#print(ToAppend)
ResEdgeList <- rbind(ResEdgeList, ToAppend)
}
}
}
ResEdgeList <- data.frame(ResEdgeList[-1,], stringsAsFactors = FALSE)
ResEdgeList<- subset(ResEdgeList, (is.na(Vertex1) == FALSE ) & (is.na(Vertex2) == FALSE ))
ResEdgeList
}
Fun_DFtoEdgeList (DF1[,-1])
``
Any help appreciated. (I had previously posted this question under different heading but am told that I wasn't clear enough)
Your code does not produce the data you give because it is iterating over the "Paper" column. It will also prove slow because everytime you append to an existing object, R has to take another copy of the entire object...when you do this iteratively, things slow to a crawl. Looking at your output, I think this is does what you want:
#First, creat all combos of the columns you want. I don't think you want to include the "Paper" column?
x <- combn(2:4,2)
#-----
[,1] [,2] [,3]
[1,] 2 2 3
[2,] 3 4 4
#next use apply to go through each pair:
apply(x, 2, function(z) data.frame(Vertex1 = DF1[, z[1]], Vertex2 = DF1[, z[2]]))
#-----
[[1]]
Vertex1 Vertex2
1 A B
2 D C
3 C F
4 C <NA>
5 C F
....
#So use do.call to rbind them together:
out <- do.call("rbind",
apply(x, 2, function(z) data.frame(Vertex1 = DF1[, z[1]], Vertex2 = DF1[, z[2]])))
#Finally, filter out the rows with NA:
out[complete.cases(out),]
#-----
Vertex1 Vertex2
1 A B
2 D C
3 C F
5 C F
6 A C
7 D E
10 C D
11 B C
12 C E
15 F D
Finally, see how this scales to a larger problem:
#Just over a million papers
zz <- matrix(sample(letters, 1000002, TRUE), ncol = 3)
x <- combn(1:3, 2)
system.time(do.call("rbind",
apply(x, 2, function(z) data.frame(Vertex1 = zz[, z[1]], Vertex2 = zz[, z[2]]))))
#-----
user system elapsed
1.332 0.144 1.482
1.5 seconds seems pretty reasonable to me?
There might be a better way to do this, but try combn, it produces all unique combinations:
DF1 <- cbind(Papers = paste('Paper', 1:5, sep = ''),
Author1 = c('A', 'D', 'C', 'C', 'C'),
Author2 = c('B', 'C', 'F', NA, 'F'),
Author3 = c('C', 'E', NA, NA, 'D'))
require(igraph)
l=apply(DF1[,-1],MARGIN=1,function(x) na.omit(data.frame(t(combn(x,m=2)))))
df=do.call(rbind,l)
g=graph.data.frame(df,directed=F)
plot(g)

create a scoring matrix from two dataframes

I am trying to compare sets of variables(X) that are stored in two dataframes (foo, bar). Each X is a unique independent variable that has up to 10 values of Y associated with it. I would like to compare every foo.X with every bar.X by comparing the number of Y values they have in common - so the output could be a matrix with axes of foo.x by bar.x in length.
this simple example of foo and bar would want to return a 2x2 matrix comparing a,b with c,d:
foo <- data.frame(x= c('a', 'a', 'a', 'b', 'b', 'b'), y=c('ab', 'ac', 'ad', 'ae', 'fx', 'fy'))
bar <- data.frame(x= c('c', 'c', 'c', 'd', 'd', 'd'), y=c('ab', 'xy', 'xz', 'xy', 'fx', 'xz'))
EDIT:
I've left the following code for other newbies to learn from (for loops are effectvie but probably very suboptimal), but the two solutions below are effective. In particular Ramnath's use of data.table is very effective when dealing with very large dataframes.
store the dataframes as lists where the values of y are stored using the stack function
foo.list <- dlply(foo, .(x), function(x) stack(x, select = y))
bar.list <- dlply(bar, .(x),function(x) stack(x, select = y))
write a function for comparing membership in the two stacked lists
comparelists <- function(list1, list2) {
for (i in list1){
for (j in list2){
count <- 0
if (i[[1]] %in% j[[1]]) count <- count + 1
}
}
return count
}
write an output matrix
output.matrix <- matrix(1:length(foo.list), 1:length(bar.list))
for (i in foo.list){
for (j in bar.list){
output.matrix[i,j] <- comparelists(i,j)
}
}
There must be a hundred ways to do this; here is one that feels relatively straightforward to me:
library(reshape2)
foo <- data.frame(x = c('a', 'a', 'a', 'b', 'b', 'b'),
y = c('ab', 'ac', 'ad', 'ae', 'fx', 'fy'))
bar <- data.frame(x = c('c', 'c', 'c', 'd', 'd', 'd'),
y = c('ab', 'xy', 'xz', 'xy', 'fx', 'xz'))
# Create a function that counts the number of common elements in two groups
nShared <- function(A, B) {
length(intersect(with(foo, y[x==A]), with(bar, y[x==B])))
}
# Enumerate all combinations of groups in foo and bar
(combos <- expand.grid(foo.x=unique(foo$x), bar.x=unique(bar$x)))
# foo.x bar.x
# 1 a c
# 2 b c
# 3 a d
# 4 b d
# Find number of elements in common among all pairs of groups
combos$n <- mapply(nShared, A=combos$foo.x, B=combos$bar.x)
# Reshape results into matrix form
dcast(combos, foo.x ~ bar.x)
# foo.x c d
# 1 a 1 0
# 2 b 0 1
Here is a simpler approach using merge
library(reshape2)
df1 <- merge(foo, bar, by = 'y')
dcast(df1, x.x ~ x.y, length)
x.x c d
1 a 1 0
2 b 0 1
EDIT. The merge can be faster using data.table. Here is the code
foo_dt <- data.table(foo, key = 'y')
bar_dt <- data.table(bar, key = 'y')
df1 <- bar_dt[foo_dt, nomatch = 0]

Concatenate expressions to subset a dataframe

I am attempting to create a function that will calculate the mean of a column in a subsetted dataframe. The trick here is that I always to want to have a couple subsetting conditions and then have the option to pass more conditions to the functions to further subset the dataframe.
Suppose my data look like this:
dat <- data.frame(var1 = rep(letters, 26), var2 = rep(letters, each = 26), var3 = runif(26^2))
head(dat)
var1 var2 var3
1 a a 0.7506109
2 b a 0.7763748
3 c a 0.6014976
4 d a 0.6229010
5 e a 0.5648263
6 f a 0.5184999
I want to be able to do the subset shown below, using the first condition in all function calls, and the second be something that can change with each function call. Additionally, the second subsetting condition could be on other variables (I'm using a single variable, var2, for parsimony, but the condition could involve multiple variables).
subset(dat, var1 %in% c('a', 'b', 'c') & var2 %in% c('a', 'b'))
var1 var2 var3
1 a a 0.7506109
2 b a 0.7763748
3 c a 0.6014976
27 a b 0.7322357
28 b b 0.4593551
29 c b 0.2951004
My example function and function call would look something like:
getMean <- function(expr) {
return(with(subset(dat, var1 %in% c('a', 'b', 'c') eval(expr)), mean(var3)))
}
getMean(expression(& var2 %in% c('a', 'b')))
An alternative call could look like:
getMean(expression(& var4 < 6 & var5 > 10))
Any help is much appreciated.
EDIT: With Wojciech Sobala's help, I came up with the following function, which gives me the option of passing in 0 or more conditions.
getMean <- function(expr = NULL) {
sub <- if(is.null(expr)) { expression(var1 %in% c('a', 'b', 'c'))
} else expression(var1 %in% c('a', 'b', 'c') & eval(expr))
return(with(subset(dat, eval(sub)), mean(var3)))
}
getMean()
getMean(expression(var2 %in% c('a', 'b')))
It can be simplified with defalut expr=TRUE.
getMean <- function(expr = TRUE) {
return(with(subset(dat, var1 %in% c('a', 'b', 'c') & eval(expr)), mean(var3)))
}
This is how I would approach it. The function getMean makes use of the R's handy default parameter settings:
getMean <- function(x, subset_var1, subset_var2=unique(x$var2)){
xs <- subset(x, x$var1 %in% subset_var1 & x$var2 %in% subset_var2)
mean(xs$var3)
}
getMean(dat, c('a', 'b', 'c'))
[1] 0.4762141
getMean(dat, c('a', 'b', 'c'), c('a', 'b'))
[1] 0.3814149

Resources