Using the PyQT library I am currently having issues with binding a function to the dinamically generated pushbuttons resulting from a loop.
So far I have managed to generate the buttons and bind a function to them with the lambda command. The problem is that since I need every single button to open a different file I find myself in an odd situation as all the button do open the same one. The last value assigned to the variable.
Any idea on how to fix the situation? As a last note, sorry in case of stupid mistakes. I am new to OOP and PyQT.
def searchTheStuff(self):
found = 0
data = MainWindow.intermediateCall()
f1 = open('Path.txt', 'r')
path = f1.read()
f1.close()
Yinc = 25
Y = 40
X = 20
results = 0
for path, dirs, files in os.walk(path, topdown=True):
for name in files:
if name.endswith('.txt'):
fullpath = os.path.join(path, name)
mail = open_close(fullpath)
if mail.find(data) != -1 and results<3:
found = 1
self.buttons.append(QtGui.QPushButton(self))
print fullpath
command = lambda : webbrowser.open()
self.buttons[-1].clicked.connect(command)
self.buttons[-1].setText(_translate("self", name, None))
self.buttons[-1].setGeometry(QtCore.QRect(X, Y, 220, 20))
results = results+1
if results == 33:
X = 260
Y = 15
Y = Y + Yinc
if found == 0:
self.label = QtGui.QLabel(self)
self.label.setGeometry(QtCore.QRect(20, 40, 321, 21))
self.label.setText(_translate("self", "No templates have been found:", None))
Related
The problem I am faced with regards to llvmlite is producing a simple hello world example.
I am unable to display the string global variable value in the function I created.
It appears to always print out the number one.
I have already tried to return the stringtype which produced a error.
from llvmlite import ir
i64 = ir.IntType(64)
i8 = ir.IntType(16)
hellostr = 'hello, world!'
stringtype = ir.ArrayType(i64, len(hellostr))
module = ir.Module( name="m_hello_example" )
hello = ir.GlobalVariable(module, stringtype, '.str4')
fn_int_to_int_type = ir.FunctionType(i64, [stringtype.as_pointer()] )
fn_hel = ir.Function( module, fn_int_to_int_type, name="fn_hel" )
fn_hel_block = fn_hel.append_basic_block( name="fn_hel_entry" )
builder = ir.IRBuilder(fn_hel_block )
# zero = builder.constant(i64, 0)
# const_1 = ir.Constant(stringtype,1);
# builder.ret(const_1)
const_1 = ir.Constant(i64,1);
# print(const_1)
builder.ret(const_1)
print( module )
I was expecting the output to print out the string 'hello, world!'.
Any help would be much appreciated.
Thanks.
It ended up that I was able to solve my problem with the following code:
import llvmlite.ir as ir
import llvmlite.binding as llvm
from ctypes import CFUNCTYPE
def main():
m = ir.Module()
func_ty = ir.FunctionType(ir.VoidType(), []) #defining printer function as type void
func = ir.Function(m, func_ty, name="printer") #define function as printer
builder = ir.IRBuilder(func.append_basic_block('entry')) #defining the entry point of the function printer
fmt = "%s\n\0" #in function printf allows for inserting arg in, next global_fmt statements allow for creating #"fstr" assignment
c_fmt = ir.Constant(ir.ArrayType(ir.IntType(8), len(fmt)),
bytearray(fmt.encode("utf8")))
global_fmt = ir.GlobalVariable(m, c_fmt.type, name="fstr")
global_fmt.linkage = 'internal'
global_fmt.global_constant = True
global_fmt.initializer = c_fmt
arg = "Hello, World!\0" #args will be passed into printf function.
c_str_val = ir.Constant(ir.ArrayType(ir.IntType(8), len(arg)),
bytearray(arg.encode("utf8"))) #creates the c_str_value as a constant
printf_ty = ir.FunctionType(ir.IntType(32), [], var_arg=True) #creation of the printf function begins here and specifies the passing of a argument
printf = ir.Function(m, printf_ty, name="printf")
c_str = builder.alloca(c_str_val.type) #creation of the allocation of the %".2" variable
builder.store(c_str_val, c_str) #store as defined on the next line below %".2"
voidptr_ty = ir.IntType(8).as_pointer()
fmt_arg = builder.bitcast(global_fmt, voidptr_ty) #creates the %".4" variable with the point pointing to the fstr
builder.call(printf, [fmt_arg, c_str]) #We are calling the prinf function with the fmt and arg and returning the value as defiend on the next line
builder.ret_void()
#Next lines are for calling llvm and returning the assembly.
llvm.initialize()
llvm.initialize_native_target()
llvm.initialize_native_asmprinter()
print(str(m)) #PRINTING OUT THE ASSEMBLY
llvm_module = llvm.parse_assembly(str(m)) #Parsing teh assembly
tm = llvm.Target.from_default_triple().create_target_machine() #creating the target machine
with llvm.create_mcjit_compiler(llvm_module, tm) as ee:
ee.finalize_object() #Making sure all modules owned by the execution engine are fully processed and usable for execution
fptr = ee.get_function_address("printer") #fptr will reference the printer function
py_func = CFUNCTYPE(None)(fptr)
py_func() #run the function printer
if __name__ == "__main__":
main()
It appears that I didn't correctly assign the variable and hence why I wasn't returning anything.
Basically, this is an interactive heatmap but the twist is that the source is updated by reading values from a file that gets updated regularly.
dont bother about the class "generator", it is just for keeping data and it runs regularly threaded
make sure a file named "Server_dump.txt" exists in the same directory of the script with a single number greater than 0 inside before u execute the bokeh script.
what basically happens is i change a number inside the file named "Server_dump.txt" by using echo 4 > Server_dump.txt on bash,
u can put any number other than 4 and the script automatically checks the file and plots the new point.
if u don't use bash, u could use a text editor , replace the number and save, and all will be the same.
the run function inside the generator class is the one which checks if this file was modified , reads the number, transforms it into x& y coords and increments the number of taps associated with these coords and gives the source x,y,taps values based on that number.
well that function works fine and each time i echo a number , the correct rectangle is plotted but,
now I want to add the functionality of that clicking on a certain rectangle triggers a callback to plot a second graph based on the coords of the clicked rectangle but i can't even get it to trigger even though i have tried other examples with selected.on_change in them and they worked fine.
*if i increase self.taps for a certain rect by writing the number to the file multiple times, color gets updated but if i hover over the rect it shows me the past values and not the latest value only .
my bokeh version is 1.0.4
from functools import partial
from random import random,randint
import threading
import time
from tornado import gen
from os.path import getmtime
from math import pi
import pandas as pd
from random import randint, random
from bokeh.io import show
from bokeh.models import LinearColorMapper, BasicTicker, widgets, PrintfTickFormatter, ColorBar, ColumnDataSource, FactorRange
from bokeh.plotting import figure, curdoc
from bokeh.layouts import row, column, gridplot
source = ColumnDataSource(data=dict(x=[], y=[], taps=[]))
doc = curdoc()
#sloppy data receiving function to change data to a plottable shape
class generator(threading.Thread):
def __init__(self):
super(generator, self).__init__()
self.chart_coords = {'x':[],'y':[],'taps':[]}
self.Pi_coords = {}
self.coord = 0
self.pos = 0
self.col = 0
self.row = 0
self.s = 0
self.t = 0
def chart_dict_gen(self,row, col):
self.col = col
self.row = row+1
self.chart_coords['x'] = [i for i in range(1,cla.row)]
self.chart_coords['y'] = [i for i in range(cla.col, 0, -1)] #reversed list because chart requires that
self.chart_coords['taps']= [0]*(row * col)
self.taps = [[0 for y in range(col)] for x in range(row)]
def Pi_dict_gen(self,row,col):
key = 1
for x in range(1,row):
for y in range(1,col):
self.Pi_coords[key] = (x,y)
key = key + 1
def Pi_to_chart(self,N):
x,y = self.Pi_coords[N][0], self.Pi_coords[N][1]
return x,y
def run(self):
while True:
if(self.t == 0):
self.t=1
continue
time.sleep(0.1)
h = getmtime("Server_dump.txt")
if self.s != h:
self.s = h
with open('Server_dump.txt') as f:
m = next(f)
y,x = self.Pi_to_chart(int(m))
self.taps[x][y] += 1
# but update the document from callback
doc.add_next_tick_callback(partial(update, x=x, y=y, taps=self.taps[x][y]))
cla = generator()
cla.chart_dict_gen(15,15)
cla.Pi_dict_gen(15, 15)
x = cla.chart_coords['x']
y = cla.chart_coords['y']
taps = cla.chart_coords['taps']
#gen.coroutine
def update(x, y, taps):
taps += taps
print(x,y,taps)
source.stream(dict(x=[x], y=[y], taps=[taps]))
colors = ["#CCEBFF","#B2E0FF","#99D6FF","#80CCFF","#66c2FF","#4DB8FF","#33ADFF","#19A3FF", "#0099FF", "#008AE6", "#007ACC","#006BB2", "#005C99", "#004C80", "#003D66", "#002E4C", "#001F33", "#000F1A", "#000000"]
mapper = LinearColorMapper(palette=colors, low= 0, high= 15) #low = min(cla.chart_coords['taps']) high = max(cla.chart_coords['taps'])
TOOLS = "hover,save,pan,box_zoom,reset,wheel_zoom"
p = figure(title="Tou",
x_range=list(map(str,x)),
y_range=list(map(str,reversed(y))),
x_axis_location="above",
plot_width=900, plot_height=400,
tools=TOOLS, toolbar_location='below',
tooltips=[('coords', '#y #x'), ('taps', '#taps%')])
p.grid.grid_line_color = "#ffffff"
p.axis.axis_line_color = "#ef4723"
p.axis.major_tick_line_color = "#af0a36"
p.axis.major_label_text_font_size = "7pt"
p.xgrid.grid_line_color = None
p.ygrid.grid_line_color = None
p.rect(x="x", y="y",
width=0.9, height=0.9,
source=source,
fill_color={'field': 'taps', 'transform': mapper},
line_color = "#ffffff",
)
color_bar = ColorBar(color_mapper=mapper,
major_label_text_font_size="7pt",
ticker=BasicTicker(desired_num_ticks=len(colors)),
formatter=PrintfTickFormatter(format="%d%%"),
label_standoff=6, border_line_color=None, location=(0, 0))
curdoc().theme = 'dark_minimal'
def ck(attr, old, new):
print('here') #doesn't even print hi in the terminal if i click anywhere
source.selected.on_change('indices', ck)
p.add_layout(color_bar, 'right')
doc.add_root(p)
thread = cla
thread.start()
i wanted even to get a printed hi in the terminal but nothing
You have not actually added any selection tool at all to your plot, so no selection is ever made. You have specified:
TOOLS = "hover,save,pan,box_zoom,reset,wheel_zoom"
Those are the only tools that will be added, and none of them make selections, there for nothing will cause source.selection.indices to ever be updated. If you are looking for selections based on tap, you must add a TapTool, e.g. with
TOOLS = "hover,save,pan,box_zoom,reset,wheel_zoom,tap"
Note that there will not be repeated callbacks if you tap the same rect multiple times. The callback only fires when the selection changes and clicking the same glyph twice in a row results in an identical selection.
I am new to PyqtGraph ( Infact this is my first time)
I have a Qt designer file which I import in my python code. I 6 windows in which I plot a 42x22 (different sizes) as an inmage, these have been promoted the graphicview.
I have a data set which is 6x42x22 and so I use a for loop to plot the 6 images
for n in range(imageStackSize):
self.glayout = pg.GraphicsLayout()
self.vb = self.glayout.addViewBox()
self.vb.setAspectLocked(lock=True, ratio=self.aspect_ratio)
img_temp = image[n, :, :]
and...
``
img = pg.ImageItem(img_temp, lut=self.jet_lut)
if n == 0:
self.ui.Channel1_img.setCentralItem(self.glayout)
self.vb.addItem(img)
elif n == 1:
self.ui.Channel2_img.setCentralItem(self.glayout)
self.vb.addItem(img)
elif n == 2:
self.ui.Channel3_img.setCentralItem(self.glayout)
self.vb.addItem(img)
elif n == 3:
self.ui.Channel4_img.setCentralItem(self.glayout)
self.vb.addItem(img)
elif n == 4:
self.ui.Channel5_img.setCentralItem(self.glayout)
self.vb.addItem(img)
elif n == 5:
self.ui.Channel6_img.setCentralItem(self.glayout)
self.vb.addItem(img)
After this I am trying to click on one of the image (ideally I would like to make it such that I can click any of the six images) to get the (6,x,y) coordinated the first dimension does not matter. In order to achieve this I did
self.ui.Channel1_img.scene().sigMouseClicked.connect(self.onClick)
#self.ui.Channel2_img.scene().sigMouseClicked.connect(self.onClick)
#self.ui.Channel3_img.scene().sigMouseClicked.connect(self.onClick)
#self.ui.Channel4_img.scene().sigMouseClicked.connect(self.onClick)
#self.ui.Channel5_img.scene().sigMouseClicked.connect(self.onClick)
#self.ui.Channel6_img.scene().sigMouseClicked.connect(self.onClick)
#self.ui.PMTVoltage_plt.scene().sigMouseClicked.connect(self.onClick)
def onClick(self, event):
print("clicked")
and then I tried
items = self.ui.Channel1_img.imageItem.mapFromViewToItem(event.pos())
and
items = self.ui.Channel1_img.imageItem.mapFromSceneToView(event.pos())
but the prog just crashes. I read somewhere that the coordinates are in the viewbox, but I cant seem to find the viewbox or vb in the self.ui.Channel1_img
I went through the entire ui variable in debug to look for vb or image Item and could not find it.
infact the only thing I found was,
items = {dict} {<pyqtgraph.graphicsItems.ViewBox.ViewBox.ViewBox
object at 0x000001CF73888CA8>: [(0, 0)]}
<pyqtgraph.graphicsItems.ViewBox.ViewBox.ViewBox object at
0x000001CF73888CA8> (1990508186792) = {list} <class 'list'>: [(0, 0)]
0 = {tuple} <class 'tuple'>: (0, 0)
0 = {int} 0
1 = {int} 0
__len__ = {int} 2
__len__ = {int} 1
__len__ = {int} 1
what am I missing? Any help is appreciated
Ok I figured it out, here is my solution for some who may have same question
I plot the data using it as imageItem
vb = pg.ViewBox()
self.ui.PMTVoltage_plt.useOpenGL()
self.ui.PMTVoltage_plt.setCentralItem(vb)
self.img = pg.ImageItem(pmtImage)
vb.addItem(self.img)
and then in other function I recover the vb using getViewBox() and then use mapFromViewtoItem()
vb = self.ui.PMTVoltage_plt.getViewBox()
items = vb.mapSceneToView(event.scenePos())
pixels = vb.mapFromViewToItem(self.img, items)
print(items)
Hope this helps
I'm using Python 3.4.2 and PyPDF2 1.24 (also using reportlab 3.1.44 in case that helps) on windows 7.
I recently upgraded from Python 2.7 to 3.4, and am in the process of porting my code. This code is used to create a blank pdf page with links embedded in it (using reportlab) and merge it (using PyPDF2) with an existing pdf page. I had an issue with reportlab in that saving the canvas used StringIO which needed to be changed to BytesIO, but after doing that I ran into this error:
Traceback (most recent call last):
File "C:\cms_software\pdf_replica\builder.py", line 401, in merge_pdf_files
input_page.mergePage(link_page)
File "C:\Python34\lib\site-packages\PyPDF2\pdf.py", line 2013, in mergePage
self.mergePage(page2)
File "C:\Python34\lib\site-packages\PyPDF2\pdf.py", line 2059, in mergePage
page2Content = PageObject._pushPopGS(page2Content, self.pdf)
File "C:\Python34\lib\site-packages\PyPDF2\pdf.py", line 1973, in _pushPopGS
stream = ContentStream(contents, pdf)
File "C:\Python34\lib\site-packages\PyPDF2\pdf.py", line 2446, in __init
stream = BytesIO(b_(stream.getData()))
File "C:\Python34\lib\site-packages\PyPDF2\generic.py", line 826, in getData
decoded._data = filters.decodeStreamData(self)
File "C:\Python34\lib\site-packages\PyPDF2\filters.py", line 326, in decodeStreamData
data = ASCII85Decode.decode(data)
File "C:\Python34\lib\site-packages\PyPDF2\filters.py", line 264, in decode
data = [y for y in data if not (y in ' \n\r\t')]
File "C:\Python34\lib\site-packages\PyPDF2\filters.py", line 264, in
data = [y for y in data if not (y in ' \n\r\t')]
TypeError: 'in <string>' requires string as left operand, not int
Here is the line and the line above where the traceback mentions:
link_page = self.make_pdf_link_page(pdf, size, margin, scale_factor, debug_article_links)
if link_page != None:
input_page.mergePage(link_page)
Here are the relevant parts of that make_pdf_link_page function:
packet = io.BytesIO()
can = canvas.Canvas(packet, pagesize=(size['width'], size['height']))
....# left out code here is just reportlab specifics for size and url stuff
can.linkURL(url, r1, thickness=1, color=colors.green)
can.rect(x1, y1, width, height, stroke=1, fill=0)
# create a new PDF with Reportlab that has the url link embedded
can.save()
packet.seek(0)
try:
new_pdf = PdfFileReader(packet)
except Exception as e:
logger.exception('e')
return None
return new_pdf.getPage(0)
I'm assuming it's a problem with using BytesIO, but I can't create the page with reportlab with StringIO. This is a critical feature that used to work perfectly with Python 2.7, so I'd appreciate any kind of feedback on this. Thanks!
UPDATE:
I've also tried changing from using BytesIO to just writing to a temp file, then merging. Unfortunately I got the same error.
Here is tempfile version:
import tempfile
temp_dir = tempfile.gettempdir()
temp_path = os.path.join(temp_dir, "tmp.pdf")
can = canvas.Canvas(temp_path, pagesize=(size['width'], size['height']))
....
can.showPage()
can.save()
try:
new_pdf = PdfFileReader(temp_path)
except Exception as e:
logger.exception('e')
return None
return new_pdf.getPage(0)
UPDATE:
I found an interesting bit of information on this. It seems if I comment out the can.rect and can.linkURL calls it will merge. So drawing anything on a page, then trying to merge it with my existing pdf is causing the error.
After digging in to PyPDF2 library code, I was able to find my own answer. For python 3 users, old libraries can be tricky. Even if they say they support python 3, they don't necessarily test everything. In this case, the problem was with the class ASCII85Decode in filters.py in PyPDF2. For python 3, this class needs to return bytes. I borrowed the code for this same type of function from pdfminer3k, which is a port for python 3 of pdfminer. If you exchange the ASCII85Decode() class for this code, it will work:
import struct
class ASCII85Decode(object):
def decode(data, decodeParms=None):
if isinstance(data, str):
data = data.encode('ascii')
n = b = 0
out = bytearray()
for c in data:
if ord('!') <= c and c <= ord('u'):
n += 1
b = b*85+(c-33)
if n == 5:
out += struct.pack(b'>L',b)
n = b = 0
elif c == ord('z'):
assert n == 0
out += b'\0\0\0\0'
elif c == ord('~'):
if n:
for _ in range(5-n):
b = b*85+84
out += struct.pack(b'>L',b)[:n-1]
break
return bytes(out)
I have already discussed a similar type of a question in this following post
How to set a for -loop in R
each file contents as follows:
FILE_1.FASTA
>>TTBK2_Hsap ,(CK1/TTBK)
MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFT
FILE_2.FASTA
>>TTBK2_Hsap ,(CK1/TTBK)
MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFT
However, there is another package in R which works like this:
extractAPAAC(x, props = c("Hydrophobicity", "Hydrophilicity"), lambda = 30,
w = 0.05, customprops = NULL)
I tried creating a function to run it for number of file sequences and the program looks like this
read_and_extract <- function(fasta) {
seq <- readFASTA(fasta)[[1]]
return(extractAPAAC(seq, props = c("Hydrophobicity", "Hydrophilicity"), lambda = 30,
w = 0.05, customprops = NULL))
}
setwd("H:\\CC")
fasta_files <- dir(pattern = "[.]fasta$")
aa_comp <- vapply(fasta_files, read_and_extract, rep(pi, 80))
write.csv(aa_comp, file = "C:\\Users\\PAAC.csv")
This programs shows an error
Error: unexpected ',' in "w = 0.05,"
But I have given w=0.05 as of default value, could anyone tell me where is the actual problem?